PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.001G009800.1
Common NamePHAVU_001G009800g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family SRS
Protein Properties Length: 334aa    MW: 36016.5 Da    PI: 7.7038
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.001G009800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF7022236.1e-691212723153
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrelkskkq..salsstk 90 
                          g+++CqdCGnqakkdC+h RCRtCCksrgf+C+thvkstWvpaakrrerqqqla+++++++  + + ++skr+re+ + ++   +l+++ 
  Phvul.001G009800.1 121 GGGMNCQDCGNQAKKDCSHLRCRTCCKSRGFQCQTHVKSTWVPAAKRRERQQQLATLQQQNQPPQfRGDHSKRHRESIEGAAagGSLACAP 211
                         5789***************************************************998877655559999999999955544005566666 PP

              DUF702  91 lssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                         l+ +  ++ le+ ++P+e++s+avfrcv+vs++d  +e +aYqtav+igGhvfkGiLydqG++
  Phvul.001G009800.1 212 LPIT--TTGLEVGQFPPELNSPAVFRCVKVSAMDAPDERYAYQTAVNIGGHVFKGILYDQGMD 272
                         6655..5679999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.8E-65123272IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-26125167IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.1E-24223271IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0048467Biological Processgynoecium development
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAGFFSLGGR HNKAEQEEDQ REDNNTNNTN HNNSQFLFRN VNEEIYNTNK GFEIWPQSSY  60
HHNFTNYYSF GVGPSRRNNA NTNNSSSNNV NDDVSVSFSD DSNRFGFTVM RSAGGVGGGG  120
GGGMNCQDCG NQAKKDCSHL RCRTCCKSRG FQCQTHVKST WVPAAKRRER QQQLATLQQQ  180
NQPPQFRGDH SKRHRESIEG AAAGGSLACA PLPITTTGLE VGQFPPELNS PAVFRCVKVS  240
AMDAPDERYA YQTAVNIGGH VFKGILYDQG MDGPYASAGC EGSSGGGGEA RALTLMAATT  300
TATTAGNPFD ASLYTAPMNA FMAGTQFFPP PRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-162AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007160701.10.0hypothetical protein PHAVU_001G009800g
SwissprotQ9FXH75e-84SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
SwissprotQ9LQZ56e-84SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV7CTW60.0V7CTW6_PHAVU; Uncharacterized protein
STRINGGLYMA14G40660.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.17e-74SHI-related sequence 5